General Information

  • ID:  hor002661
  • Uniprot ID:  G5EGC3
  • Protein name:  NLP-37
  • Gene name:  pdf-2
  • Organism:  Caenorhabditis elegans
  • Family:  NA
  • Source:  animal
  • Expression:  Expressed in the interneurons BDUL/R, AVG, AIML/R, RIS, AVD and PVT, the chemosensory neuron pairs PHA and PHB, the motor neurons RID and RIML/R, the sensory neurons AQR and PQR, and in the PVPL/R interneurons .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007567 parturition; GO:0035641 locomotory exploration behavior; GO:0040011 locomotion; GO:0045475 locomotor rhythm
  • GO CC:  NA

Sequence Information

  • Sequence:  NNAEVVNHILKNFGALDRLGDV
  • Length:  22(66-87)
  • Propeptide:  MSSRISVSLLLLAVVATMFFTANVVDATPRSQGNMMRYGNSLPAYAPHVLYRFYNSRQFAPINKRNNAEVVNHILKNFGALDRLGDVGK
  • Signal peptide:  MSSRISVSLLLLAVVATMFFTANVVDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Probable ligand of isoforms a and b of the calcitonin receptor-like protein, pdfr-1, a G-protein coupled receptor (PubMed:18390545). May not signal through isoform c of pdfr-1 (PubMed:18390545). Involved in locomotion; may play a role in circadian rhythms
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  pdfr-1
  • Target Unid:  Q09460
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-G5EGC3-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002661_AF2.pdbhor002661_ESM.pdb

Physical Information

Mass: 278348 Formula: C105H170N32O33
Absent amino acids: CMPQSTWY Common amino acids: N
pI: 5.52 Basic residues: 3
Polar residues: 6 Hydrophobic residues: 10
Hydrophobicity: -9.09 Boman Index: -3566
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 119.55
Instability Index: 2029.55 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20013198
  • Title:  Approaches to Identify Endogenous Peptides in the Soil Nematode Caenorhabditis elegans